PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10435446g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 1170aa    MW: 127488 Da    PI: 6.9517
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10435446g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-098729091954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  MA_10435446g0010 872 FEHflHPYPTDADKHMLARQTGLSRSQVSNWFINARVR 909
                       554459******************************88 PP

2BELL117.18.3e-38735805272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       r e+q+++akLls+leeV++rY qy+eq+++v+ sFe +aglg+a+pYt+lAlka+SrhF+cL+dai +q+
  MA_10435446g0010 735 RFEIQRRRAKLLSMLEEVHRRYGQYCEQMKMVVTSFESIAGLGAATPYTALALKAMSRHFKCLRDAINNQL 805
                       779*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.9E-56634803IPR006563POX domain
PfamPF075262.5E-47639801IPR006563POX domain
PROSITE profilePS5007112.568850913IPR001356Homeobox domain
CDDcd000863.26E-13853914No hitNo description
SMARTSM003891.8E-10853917IPR001356Homeobox domain
SuperFamilySSF466893.89E-17855920IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28856919IPR009057Homeodomain-like
PfamPF059209.5E-19870909IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1170 aa     Download sequence    Send to blast
MFGLHNTRAF FPKSEPVKIS SIRCIAKLAS EIESTTESFV STIGIQTDTS GFSNYILQQS  60
PQSVITTEEH NQTRSRDSSR GYPGHPTQAN TADEMPMYDA SMISSEMYNF PTGAELLGVS  120
PKGIVLQQDS SEDGSNQPSA MGAVSYSSFG HSNSNFSSSK TSIVPNLGNW KSLNTPSNND  180
WPIKFIHGLR NAPSGAYGRH NTIATPLVLA GEAHNQTRSR DSSRGYPGHP TQANTGDEMP  240
MYDASMLSSE MYNFPTGAEL LGVPPKGIVL QQASSEDGSD RPSAMGAVSY SSFGHSNSNF  300
SGSKTSIVPN LGNWKSLNTP SNSDWPIKFI HGLPNAPSGA YGGQNTIATP LVLAGGGLQA  360
GVVKDGSLAA STNIHSQADA MQLYLMNPAY AGYPENSPPA TMHPSNDNVA NQGQESQKHI  420
VEVPLQFPSF QQNALPMVAE VATSTVGSQG FCFAQLPSNL RESAQSQWPS GGNELVLMPS  480
YGNIQNGQYL SPRLNNAMNW GNRQAGSLPN SQWNQEPFVE GKVEDEFRTE QLSVGRDRSG  540
QGLSLSLSSH QPSEMQLQQF EAMTGRTNVL QVATDGKGKS EELFNRPGTN GPGYFSSYSK  600
DGIPGKGYGN PIQGGGGGST MVLHMNVGPL GPFTGYASVL KSSKYLKPAQ QLLDEFCNVG  660
RGHQSNNMPK QKLSKPQTGW VDRSSGGGSV VQNSLDIKSD IGGKMGDSCA AASTTFVPGE  720
TSENGMEQLA YSGDRFEIQR RRAKLLSMLE EVHRRYGQYC EQMKMVVTSF ESIAGLGAAT  780
PYTALALKAM SRHFKCLRDA INNQLRVTSK ALGEDSSLAG VSKGETPRLR FIDQNIRQQR  840
AVQHLGMLEQ HAWRPQRGLP ERSVSVLRAW LFEHFLHPYP TDADKHMLAR QTGLSRSQVS  900
NWFINARVRL WKPMVEEMYL QESKDSSEMD ITLKRKENDS RDKTECLGSE KNMNKHGKMM  960
LDGGSDKQSA SEGGGSKYEH GGSTSQTGQE SSGTAMSMPL ESQFRPAEKV DGMREVDMSA  1020
NRNVRETQSL SSVNVATIGV DRRLEETPGC QNFDHSTKRF RNDDRNKLQG FENTIDFSSY  1080
NHSSAIGGRY SHEDFTPRQF GSAGVSLTLG LRHSGGQEKY SNGLYLSRDD SAPDSNHHYN  1140
IHDSHDQGYG SGFDAQDMQF RKHVGSQLMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A4e-16859916158Homeobox protein Meis1
4xrs_B4e-16859916158Homeobox protein Meis1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6782200.0EF678220.1 Picea sitchensis clone WS0285_A17 unknown mRNA.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.35e-98BEL1-like homeodomain 4